PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G373000.1.p
Common NameSb03g041360, SORBIDRAFT_03g041360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 270aa    MW: 29093.2 Da    PI: 9.0563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G373000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.003G373000.1.p 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                          79******************************99************97 PP

2Myb_DNA-binding53.94.2e-1767111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T ++de++++++++lG++ W++Ia  ++ gRt++++k++w+++
  Sobic.003G373000.1.p  67 RGNFTDDDDEIIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.243961IPR017930Myb domain
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
SuperFamilySSF466896.6E-2913108IPR009057Homeodomain-like
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.59E-121661No hitNo description
PROSITE profilePS5129427.54662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2765116IPR009057Homeodomain-like
SMARTSM007175.9E-1666114IPR001005SANT/Myb domain
PfamPF002496.3E-1567111IPR001005SANT/Myb domain
CDDcd001673.09E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDDDEIIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPQTHRPLS GGAAAGSGLT TSSTAGFPAQ APAPTRPARP VIIIPPNVMF ARPAPSEDGH  180
SSSGGSTDAP RCPDLNLDLD LSVGPPCSPP KTPAAAVTTP TSQQQEMQRA TICLCYHLGV  240
RSGDACSCKT AASPAGFRFL RPLEEGQYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0354470.0BT035447.1 Zea mays full-length cDNA clone ZM_BFb0063G11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.10.0hypothetical protein SORBIDRAFT_03g041360
SwissprotP813934e-97MYB08_ANTMA; Myb-related protein 308
TrEMBLC5XRB40.0C5XRB4_SORBI; Putative uncharacterized protein Sb03g041360
STRINGSb03g041360.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-87myb domain protein 6